Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0051

Oxidized P. aeruginosa ferricytochrome c(551)

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Cytochrome c-551
Organism: Shigella dysenteriae WRSd3
Number of residues: 82
Related UniProt entry:   P00099 (Fragment: 23 - 104)
Related PDB entry:   451C

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.0; 25.0 Celsius; Probes: 31

Related publication:
 PMID 12459911

Experiment details: "Hydrogen-exchange rates were measured by monitoring the change in the TOCSY or 1D amide proton peak intensity as a function of time after exchanging a lyophilized sample into D2O. To initiate hydrogen exchange, a sample of oxidized Pa cyt c551 (3.0 mM protein, 5 times molar excess K3[Fe(CN)6], 50 mM NaPi pH 6.0) was lyophilized and dissolved in D2O. The pH* (uncorrected pH value) was immediately adjusted to 6.0 and data acquisition began 8 min after commencement of exchange. 1D (8 scans) and 2D TOCSY (32 scans) spectra were collected without solvent suppression using a Varian INOVA 500 MHz spectrometer at 300 K. Each TOCSY spectrum (4,096 ·256 points, with a 1.1-s recycle time) took about 5 h to acquire. TOCSY data were collected at 8, 13, 18, 25, 32, 37, 42, 96, and 317 h after initiation of exchange."

Protection threshold: log(P) >~ 5

Sequence: EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

16: H; 47: R; 49: K; 50: N; 51: G; 52: S; 61: M; 72: Q; 74: L; 76: K; 77: W; 79: L; 80: S;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

MEDIUM

Method: Native exchange NMR

Conditions: pH 6.0; 25.0 Celsius; Probes: 31

Related publication:
 PMID 12459911

Experiment details: "Hydrogen-exchange rates were measured by monitoring the change in the TOCSY or 1D amide proton peak intensity as a function of time after exchanging a lyophilized sample into D2O. To initiate hydrogen exchange, a sample of oxidized Pa cyt c551 (3.0 mM protein, 5 times molar excess K3[Fe(CN)6], 50 mM NaPi pH 6.0) was lyophilized and dissolved in D2O. The pH* (uncorrected pH value) was immediately adjusted to 6.0 and data acquisition began 8 min after commencement of exchange. 1D (8 scans) and 2D TOCSY (32 scans) spectra were collected without solvent suppression using a Varian INOVA 500 MHz spectrometer at 300 K. Each TOCSY spectrum (4,096 ·256 points, with a 1.1-s recycle time) took about 5 h to acquire. TOCSY data were collected at 8, 13, 18, 25, 32, 37, 42, 96, and 317 h after initiation of exchange."

Protection threshold: 4 < log(P) < 5

Sequence: EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

MEDIUM residues

15: C; 17: A; 24: G; 28: K; 30: V; 31: A; 32: A; 33: K; 44: L; 45: A; 46: Q; 48: I; 55: V; 64: N; 71: A; 73: T; 75: A; 78: V;
 CLICK TO DOWNLOAD LIST OF RESIDUES