Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0049

Alpha-lactalbumin (human)

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Alpha-lactalbumin
Organism: Homo sapiens (Human)
Number of residues: 123
Related UniProt entry:   P00709 (Fragment: 21 - 142)
Related PDB entry:   3B0O

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.3; 15.0 Celsius; Probes: 45

Related publication:
 PMID 7473740

Experiment details: "Hydrogen-deuterium exchange was initiated by dissolving lyophilized samples either in D2O, pH* 2 (molten globule) or native exchange buffer (100 mM d4-imidazole, 3 mM CaCl2 with a final pH* of 6.3). The protein concentration was 80 mM for exchange in the molten globule and 800 mM for exchange in the native state. For the molten globule, exchange was quenched by freezing in liquid nitrogen and subsequent lyophilization at regular intervals from ten seconds to nine days. Dry samples were stored at −80 °C and dissolved in native exchange buffer for analysis."

Protection threshold: k(int)/k(ex) > 100000

Sequence: MQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

33: T; 61: C; 73: C; 77: C; 80: F; 91: C; 92: A; 93: K; 94: K;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

STRONG

Method: Native exchange in partially folded state by NMR

Conditions: pH 2.0; 5.0 Celsius; Probes: 34

Related publication:
 PMID 7473740

Experiment details: "Hydrogen-deuterium exchange was initiated by dissolving lyophilized samples either in D2O, pH* 2 (molten globule) or native exchange buffer (100 mM d4-imidazole, 3 mM CaCl2 with a final pH* of 6.3). The protein concentration was 80 mM for exchange in the molten globule and 800 mM for exchange in the native state. For the molten globule, exchange was quenched by freezing in liquid nitrogen and subsequent lyophilization at regular intervals from ten seconds to nine days. Dry samples were stored at −80 °C and dissolved in native exchange buffer for analysis."

Protection threshold: k(int)/k(ex) > 100

Sequence: MQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

26: L; 27: I; 30: M; 33: T;
 CLICK TO DOWNLOAD LIST OF RESIDUES