Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0048

Alpha-lactalbumin (guinea pig)

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Alpha-lactalbumin
Organism: Cavia porcellus (Guinea pig)
Number of residues: 123
Related UniProt entry:   P00713 (Fragment: 20 - 142)
Related PDB entry:   1HFX

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange in partially folded state by NMR

Conditions: pH 2.0; 25.0 Celsius; Probes: 21

Related publication:
 PMID 8504087

Experiment details: "The hydrogen exchange kinetics of individual amide protons in the A-state at pH 2.0 were measured by pH-jump experiments which were performed in three steps: (a) Fully protonated GPLA was dissolved in H2O, the pH was lowered to 2.0, and then the protein was lyophilized. (b) The protein was then dissolved in D2O, giving a solution of the A-state without the need for further pH adjustment. (c) After various lengths of time, aliquots of the protein were restored to the native state by carefully raising the pH to 5.5. The indole hydrogen of W26 has the highest protection factor of > 920."

Protection threshold: P > 70

Sequence: KQLTKCALSHELNDLAGYRDITLPEWLCIIFHISGYDTQAIVKNSDHKEYGLFQINDKDFCESSTTVQSRNICDISCDKLLDDDLTDDIMCVKKILDIKGIDYWLAHKPLCSDKLEQWYCEAQ
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

26: W; 28: C; 29: I; 30: I; 31: F; 95: I; 96: L;
 CLICK TO DOWNLOAD LIST OF RESIDUES