Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0045

Protein A B-domain

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Immunoglobulin G-binding protein A
Organism: Homo sapiens (Human)
Number of residues: 58
Related UniProt entry:   P38507 (Fragment: 212 - 270)
Related PDB entry:   1BDD

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 7.0; 20.0 Celsius; Probes: 28

Related publication:
 PMID 9232646

Experiment details: "Equilibrium hydrogen exchange experiments were performed by dissolving lyophilized protein directly in potassium phosphate buffer (100 mM, pH* 7.0) in D2O containing various concentrations (0 - 3.0 M) of GdmC1. The GdmCl solution in D2O was prepared by addition of a measured volume of D2O to a weighed sample of deuterated GdmCl. Exchange rates were measured by recording 1H-15N HSQC spectra as a function of time without removing the sample from the magnet."

Protection threshold: ΔG(op) > 6 kcal/mol

Sequence: TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

28: R; 35: L; 49: A; 50: K; 51: K;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

EARLY

Method: Pulse labeling HDX NMR

Conditions: pH 5.0; 5.0 Celsius; Probes: 20

Related publication:
 PMID 9232646

Experiment details: "Pulsed H/D exchange measurements were performed at 5 °C. The B-domain of protein A at a concentration of about 3 mg/mL was first unfolded in 6.0 M GdmC1 at pH 5.0 using 10 mM sodium acetate buffer in H2O. Folding was initiated by six times dilution with D2O buffer at pH* 5.0 and was allowed to continue for 6 ms before the labeling pulse was applied for 10 ms. The pulse buffer contained 0.5 M Tris adjusted to pH* 11.5 using KOD. This leads to a pulse of pH* 10.5 after mixing with the folding buffer. The exchange was quenched by D2O buffer containing 0.5 M Tris and 100 mM acetic acid at pH* 0.5. The final pH* of the solution was 4.8 after the quench."

Protection threshold: proton occupancy > 0.7 at 6 ms refolding time

Sequence: TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

EARLY residues

14: F; 15: Y; 16: E; 17: I; 18: L; 20: L; 22: N; 23: L; 28: R; 29: N; 31: F; 34: S; 35: L; 36: K; 47: A; 48: E; 49: A; 50: K; 51: K; 52: L;
 CLICK TO DOWNLOAD LIST OF RESIDUES