Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0043

Interleukin-1b subunit

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Interleukin-1 beta
Organism: Homo sapiens (Human)
Number of residues: 153
Related UniProt entry:   P01584 (Fragment: 117 - 269)
Related PDB entry:   1I1B

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.1; 36.0 Celsius; Probes: 73

Related publication:
 PMID 2372550

Experiment details: "We have made accurate measurements of the exchange rates of 73 slowly amide NH groups in IL-1b by following the intensities of the 15N-'H correlation peaks in a series of double INEPT "Overbodenhausen" experiments recorded after dissolving freeze-dried protein into D2O."

Protection threshold: exchange half-lives longer than 20 days

Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

68: Y; 69: L; 72: V; 81: Q; 83: E; 100: V; 101: F; 113: E; 115: A; 117: F; 121: Y;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

EARLY

Method: Quenched-flow HDX NMR

Conditions: pH 5.0; 4.0 Celsius; Probes: 47

Related publication:
 PMID 8493553

Experiment details: "Fully unfolded protein in D2O at pH 5.0 is allowed to fold for a length of time T, after which it is subjected to a 16-ms exchange pulse in H2O at pH 9.3, followed immediately by a quench pulse at pH 5.0."

Protection threshold: amide protection half-lives between 0.7 and 1.5 s

Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

EARLY residues

42: F; 68: Y; 69: L; 70: S; 72: V; 79: T; 81: Q; 83: E; 99: F; 100: V; 101: F; 102: N; 103: K; 104: I; 111: E; 113: E; 114: S; 117: F; 120: W; 121: Y; 123: S;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

INTERMEDIATE

Method: Quenched-flow HDX NMR

Conditions: pH 5.0; 4.0 Celsius; Probes: 47

Related publication:
 PMID 8493553

Experiment details: "Fully unfolded protein in D2O at pH 5.0 is allowed to fold for a length of time T, after which it is subjected to a 16-ms exchange pulse in H2O at pH 9.3, followed immediately by a quench pulse at pH 5.0."

Protection threshold: amide protection half-lives between 15 and 25 s

Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

INTERMEDIATE residues

43: S; 58: V; 71: C; 115: A; 132: V; 146: F; 147: T;
 CLICK TO DOWNLOAD LIST OF RESIDUES