Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0035

PDZ-3 from PSD-95

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Disks large homolog 4
Organism: Rattus norvegicus (Rat)
Number of residues: 119
Related UniProt entry:   P31016 (Fragment: 302 - 402)
Related PDB entry:   1BE9

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.0; 25.0 Celsius; Probes: 33

Related publication:
 PMID 15663949

Experiment details: "The experiment was done in D2O using 15N-labeled PDZ-3 at pDread 6.0 and 25 °C. The well-dispersed cross-peaks allow the exchange rate constants, k(ex), to be measured accurately for slowly exchanging amide protons."

Protection threshold: ΔG(HX) > 7 kcal/mol

Sequence: GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTN
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

18: I; 20: I; 41: F; 42: I; 58: R; 60: G; 61: D; 62: Q; 63: I; 64: L; 65: S; 66: V; 82: A; 92: I; 93: I; 94: A; 95: Q;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

MEDIUM

Method: Native exchange NMR

Conditions: pH 6.0; 25.0 Celsius; Probes: 33

Related publication:
 PMID 15663949

Experiment details: "The experiment was done in D2O using 15N-labeled PDZ-3 at pDread 6.0 and 25 °C. The well-dispersed cross-peaks allow the exchange rate constants, k(ex), to be measured accurately for slowly exchanging amide protons."

Protection threshold: 5 < ΔG(HX) (kcal/mol) < 7

Sequence: GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTN
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

MEDIUM residues

30: N; 32: I; 40: I; 43: S; 69: V; 71: L; 79: A; 80: A; 81: I; 83: L; 84: K; 90: V; 97: K;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

WEAK

Method: Native exchange NMR

Conditions: pH 6.0; 25.0 Celsius; Probes: 33

Related publication:
 PMID 15663949

Experiment details: "The experiment was done in D2O using 15N-labeled PDZ-3 at pDread 6.0 and 25 °C. The well-dispersed cross-peaks allow the exchange rate constants, k(ex), to be measured accurately for slowly exchanging amide protons."

Protection threshold: ΔGHX < 5 kcal/mol

Sequence: GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTN
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

WEAK residues

16: R; 46: L; 91: T;
 CLICK TO DOWNLOAD LIST OF RESIDUES