Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0033

Forkhead-associated (FHA) domain from Arabidopsis KAPP

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Protein phosphatase 2C 70
Organism: Arabidopsis thaliana (Mouse-ear cress)
Number of residues: 139
Related UniProt entry:   P46014 (Fragment: 180 - 313)
Related PDB entry:   1MZK

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.3; 20.0 Celsius; Probes: 44

Related publication:
 PMID 17007879

Experiment details: "The exchange rates of 44 backbone amide hydrogen atoms were measured at 20 °C at pH 6.3 using 15N transverse relaxation optimized spectroscopy (TROSY) spectra."

Protection threshold: log(P) > 4.6

Sequence: SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMA
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

3: L; 4: F; 5: L; 7: V; 9: A; 15: L; 51: A; 52: Q; 53: I; 54: T; 61: K; 63: E; 64: L; 94: V; 96: L; 97: A; 99: D; 100: D; 101: I; 102: I; 103: T; 109: K; 110: V; 111: Y; 112: V;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

MEDIUM

Method: Native exchange NMR

Conditions: pH 6.3; 20.0 Celsius; Probes: 44

Related publication:
 PMID 17007879

Experiment details: "The exchange rates of 44 backbone amide hydrogen atoms were measured at 20 °C at pH 6.3 using 15N transverse relaxation optimized spectroscopy (TROSY) spectra."

Protection threshold: 4.0 < log(P) < 4.6

Sequence: SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMA
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

MEDIUM residues

14: G; 17: H; 29: V; 30: K; 60: F; 62: W; 66: D; 69: S; 72: G; 73: T; 74: L; 105: G; 108: T;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

WEAK

Method: Native exchange NMR

Conditions: pH 6.3; 20.0 Celsius; Probes: 44

Related publication:
 PMID 17007879

Experiment details: "The exchange rates of 44 backbone amide hydrogen atoms were measured at 20 °C at pH 6.3 using 15N transverse relaxation optimized spectroscopy (TROSY) spectra."

Protection threshold: log(P) < 4.0

Sequence: SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMA
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

WEAK residues

46: V; 75: V; 85: L;
 CLICK TO DOWNLOAD LIST OF RESIDUES