Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0029

Barstar

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Barstar
Organism: Bacillus amyloliquefaciens (Bacillus velezensis)
Number of residues: 89
Related UniProt entry:   P11540 (Fragment: 2 - 90)
Related PDB entry:   1BTA

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 6.7; 32.0 Celsius; Probes: 13 +2 Trp indole protons

Related publication:
 PMID 9517545

Experiment details: "The protection factors were defined based on exchange measurements with different GdnHCl concentrations. D2O and H2O buffer solutions contained 20 mM sodium phosphate at pH 6.7, 32 °C. The reported pH of the D2O buffer is the uncorrected pH meter reading. Protection factors are provided for 0.33 M GdnHCl."

Protection threshold: P > 6000

Sequence: KKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

8: E; 11: R; 49: L; 72: Q; 78: K; 87: I;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

MEDIUM

Method: Native exchange NMR

Conditions: pH 6.7; 32.0 Celsius; Probes: 13 +2 Trp indole protons

Related publication:
 PMID 9517545

Experiment details: "The protection factors were defined based on exchange measurements with different GdnHCl concentrations. D2O and H2O buffer solutions contained 20 mM sodium phosphate at pH 6.7, 32 °C. The reported pH of the D2O buffer is the uncorrected pH meter reading. Protection factors are provided for 0.33 M GdnHCl."

Protection threshold: 2000 < P < 6000

Sequence: KKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

MEDIUM residues

16: L; 23: E; 34: L; 38: W; 39: D; 44: W; 45: V; 50: V; 52: E;
 CLICK TO DOWNLOAD LIST OF RESIDUES