Start2Fold

The database of hydrogen/deuterium exchange data on protein folding and stability

Entry STF0015

Northern leopard frog onconase

 DOWNLOAD ENTRY IN XML

Protein information

Name of the protein: Protein P-30
Organism: Lithobates pipiens (Northern leopard frog) (Rana pipiens)
Number of residues: 104
Related UniProt entry:   P22069 (Fragment: 2 - 104)
Related PDB entry:   1ONC

Visualize the data

 Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.

Experiment sets

 Show  Hide

EARLY

Method: Quenched-flow HDX NMR

Conditions: pH 5.5; 20.0 Celsius; Probes: 42

Related publication:
 PMID 19655705

Experiment details: "Quenched-flow experiments were carried out at 20 °C using a rapid mixing quenched-flow machine. In the first mixing step, refolding of protonated, unfolded ONC (in 6 M GdnHCl) was initiated by a 9-fold dilution into 50 mM sodium acetate buffer, pH 5.5. After defined refolding times (60 - 5000 ms), the samples were diluted 10-fold into D2O buffer (200 mM glycine buffer, 0.667 M GdnHCl, pD 11.0) to initiate the H/D exchange. The exchange was terminated after 8.3 ms by lowering the pH by a 2-fold dilution with D2O, containing 10 M acetic acid and 0.667 M GdnHCl."

Protection threshold: highly protected within 250 ms

Sequence: EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

EARLY residues

6: F; 7: Q; 8: K; 9: K; 10: H; 11: I; 12: T; 36: F; 37: I; 38: Y; 39: S; 44: V; 45: K; 46: A; 47: I; 48: C; 49: K; 65: L; 66: S; 67: D; 86: F; 87: C; 88: V; 89: T; 90: C; 91: E; 93: Q; 94: A; 96: V; 97: H; 99: V;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

INTERMEDIATE

Method: Quenched-flow HDX NMR

Conditions: pH 5.5; 20.0 Celsius; Probes: 42

Related publication:
 PMID 19655705

Experiment details: "Quenched-flow experiments were carried out at 20 °C using a rapid mixing quenched-flow machine. In the first mixing step, refolding of protonated, unfolded ONC (in 6 M GdnHCl) was initiated by a 9-fold dilution into 50 mM sodium acetate buffer, pH 5.5. After defined refolding times (60 - 5000 ms), the samples were diluted 10-fold into D2O buffer (200 mM glycine buffer, 0.667 M GdnHCl, pD 11.0) to initiate the H/D exchange. The exchange was terminated after 8.3 ms by lowering the pH by a 2-fold dilution with D2O, containing 10 M acetic acid and 0.667 M GdnHCl."

Protection threshold: protected after 250 ms

Sequence: EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

INTERMEDIATE residues

57: V; 59: T; 68: C; 69: N; 70: V; 76: K; 77: Y; 78: K; 80: K; 82: S; 84: N;
 CLICK TO DOWNLOAD LIST OF RESIDUES

 Show  Hide

STRONG

Method: Native exchange NMR

Conditions: pH 5.5; 20.0 Celsius; Probes: all

Related publication:
 PMID 19655705

Experiment details: "To assess native state H/D exchange in ONC, a series of 2D 15N-HSQC spectra was recorded for 3 days on an Avance II 600 NMR spectrometer after dissolving ONC in D2O buffer."

Protection threshold: amids that persist to exchange for 24 hours

Sequence: EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
 CLICK TO DOWNLOAD SEQUENCE IN FASTA

STRONG residues

6: F; 7: Q; 8: K; 9: K; 10: H; 11: I; 36: F; 37: I; 38: Y; 39: S; 44: V; 45: K; 46: A; 47: I; 48: C; 49: K; 57: V; 59: T; 65: L; 66: S; 67: D; 68: C; 69: N; 70: V; 76: K; 77: Y; 78: K; 80: K; 82: S; 84: N; 86: F; 87: C; 88: V; 89: T; 90: C; 91: E; 93: Q; 94: A; 96: V; 97: H; 99: V;
 CLICK TO DOWNLOAD LIST OF RESIDUES